Lineage for d1ie0a_ (1ie0 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1228134Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1228135Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1228369Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
  6. 1228370Protein Autoinducer-2 production protein LuxS [64295] (4 species)
    S-ribosylhomocysteinase
  7. 1228371Species Bacillus subtilis [TaxId:1423] [64296] (7 PDB entries)
  8. 1228373Domain d1ie0a_: 1ie0 A: [66120]
    complexed with gol, zn

Details for d1ie0a_

PDB Entry: 1ie0 (more details), 1.6 Å

PDB Description: crystal structure of luxs
PDB Compounds: (A:) autoinducer-2 production protein luxs

SCOPe Domain Sequences for d1ie0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ie0a_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Bacillus subtilis [TaxId: 1423]}
psvesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehlla
ftirshaekydhfdiidispmgcqtgyylvvsgeptsaeivdlledtmkeaveiteipaa
nekqcgqaklhdlegakrlmrfwlsqdkeellkvfg

SCOPe Domain Coordinates for d1ie0a_:

Click to download the PDB-style file with coordinates for d1ie0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ie0a_: