Lineage for d1idrb_ (1idr B:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
lack the first helix (A)
Protein Protozoan/bacterial hemoglobin [46460] (6 species) 
Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
Uniprot Q10784
Domain d1idrb_: 1idr B: [62302]
complexed with hem, oxy, po4
Details for d1idrb_
PDB Entry: 1idr (more details), 1.9 Å
PDB Description: crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis
PDB Compounds: (B:) hemoglobin hbnSCOPe Domain Sequences for d1idrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1idrb_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvt
SCOPe Domain Coordinates for d1idrb_:
Click to download the PDB-style file with coordinates for d1idrb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1idrb_:
- d1idrb_ first appeared in SCOP 1.57
- d1idrb_ appears in SCOPe 2.06
- d1idrb_ appears in the current release, SCOPe 2.08
View in 3D
