| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
| Protein Plant pathogenesis-related protein PR10 [75543] (2 species) |
| Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (6 PDB entries) |
| Domain d1icxa_: 1icx A: [71191] isoform llpr10.1a |
PDB Entry: 1icx (more details), 1.95 Å
SCOPe Domain Sequences for d1icxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaihd
ghtsfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfh
tkgdvlsetvrdqakfkglglfkaiegyvlahpdy
Timeline for d1icxa_: