Lineage for d1icxa_ (1icx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975505Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2975557Protein Plant pathogenesis-related protein PR10 [75543] (2 species)
  7. 2975560Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (6 PDB entries)
  8. 2975564Domain d1icxa_: 1icx A: [71191]
    isoform llpr10.1a

Details for d1icxa_

PDB Entry: 1icx (more details), 1.95 Å

PDB Description: crystal structure of pathogenesis-related protein llpr10.1a from yellow lupine
PDB Compounds: (A:) protein llr18a

SCOPe Domain Sequences for d1icxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaihd
ghtsfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfh
tkgdvlsetvrdqakfkglglfkaiegyvlahpdy

SCOPe Domain Coordinates for d1icxa_:

Click to download the PDB-style file with coordinates for d1icxa_.
(The format of our PDB-style files is described here.)

Timeline for d1icxa_: