Lineage for d1ib6a2 (1ib6 A:146-312)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. Protein Malate dehydrogenase [56329] (12 species)
  7. Species Escherichia coli [TaxId:562] [56333] (4 PDB entries)
  8. Domain d1ib6a2: 1ib6 A:146-312 [62147]
    Other proteins in same PDB: d1ib6a1, d1ib6b1, d1ib6c1, d1ib6d1
    complexed with nad, so4

Details for d1ib6a2

PDB Entry: 1ib6 (more details), 2.1 Å

PDB Description: crystal structure of r153c e. coli malate dehydrogenase
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1ib6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib6a2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]}
vttldiicsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr
iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs
qplllgkngveerksigtlsafeqnalegmldtlkkdialgqefvnk

SCOPe Domain Coordinates for d1ib6a2 are not available.

Timeline for d1ib6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ib6a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ib6b1, d1ib6b2, d1ib6c1, d1ib6c2, d1ib6d1, d1ib6d2