Lineage for d1i9ea_ (1i9e A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931485Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 931586Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries)
  8. 931599Domain d1i9ea_: 1i9e A: [66099]
    complexed with nag

Details for d1i9ea_

PDB Entry: 1i9e (more details), 2.5 Å

PDB Description: tcr domain
PDB Compounds: (A:) cytotoxic tcell valpha domain

SCOPe Domain Sequences for d1i9ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpyiqn

SCOPe Domain Coordinates for d1i9ea_:

Click to download the PDB-style file with coordinates for d1i9ea_.
(The format of our PDB-style files is described here.)

Timeline for d1i9ea_: