Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) fold elaborated with additional structures |
Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
Protein Ribosomal protein S2 [52315] (3 species) |
Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries) Uniprot P80371 |
Domain d1i94b_: 1i94 B: [61991] Other proteins in same PDB: d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_ complexed with mg, wo2, zn |
PDB Entry: 1i94 (more details), 3.2 Å
SCOPe Domain Sequences for d1i94b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i94b_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} pveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedl amrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleeleal faspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklf ipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe aeatetpeg
Timeline for d1i94b_: