Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.5: Synapsin domain [52463] (2 proteins) automatically mapped to Pfam PF02078 |
Protein Synapsin II [89635] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [89636] (2 PDB entries) |
Domain d1i7na1: 1i7n A:113-214 [83681] Other proteins in same PDB: d1i7na2, d1i7nb2 |
PDB Entry: 1i7n (more details), 1.9 Å
SCOPe Domain Sequences for d1i7na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7na1 c.30.1.5 (A:113-214) Synapsin II {Norway rat (Rattus norvegicus) [TaxId: 10116]} kakvllvvdephtdwakcfrgkkilgdydikveqaefselnlvahadgtyavdmqvlrng tkvvrsfrpdfvlirqhafgmaenedfrhlvigmqyaglpsi
Timeline for d1i7na1: