Lineage for d1i7na1 (1i7n A:113-214)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470351Family c.30.1.5: Synapsin domain [52463] (2 proteins)
    automatically mapped to Pfam PF02078
  6. 2470369Protein Synapsin II [89635] (1 species)
  7. 2470370Species Norway rat (Rattus norvegicus) [TaxId:10116] [89636] (2 PDB entries)
  8. 2470371Domain d1i7na1: 1i7n A:113-214 [83681]
    Other proteins in same PDB: d1i7na2, d1i7nb2

Details for d1i7na1

PDB Entry: 1i7n (more details), 1.9 Å

PDB Description: crystal structure analysis of the c domain of synapsin ii from rat brain
PDB Compounds: (A:) synapsin II

SCOPe Domain Sequences for d1i7na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7na1 c.30.1.5 (A:113-214) Synapsin II {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kakvllvvdephtdwakcfrgkkilgdydikveqaefselnlvahadgtyavdmqvlrng
tkvvrsfrpdfvlirqhafgmaenedfrhlvigmqyaglpsi

SCOPe Domain Coordinates for d1i7na1:

Click to download the PDB-style file with coordinates for d1i7na1.
(The format of our PDB-style files is described here.)

Timeline for d1i7na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i7na2