Lineage for d1i6wa_ (1i6w A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
lack the first two strands of the common fold
Protein Lipase A [64145] (3 species)
minimal alpha/beta hydrolase fold;Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries)
Uniprot P37957 34-212
Domain d1i6wa_: 1i6w A: [61859]
complexed with cd
Details for d1i6wa_
PDB Entry: 1i6w (more details), 1.5 Å
PDB Description: the crystal structure of bacillus subtilis lipase: a minimal alpha/beta hydrolase enzyme
PDB Compounds: (A:) lipase aSCOPe Domain Sequences for d1i6wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6wa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn
SCOPe Domain Coordinates for d1i6wa_:
Click to download the PDB-style file with coordinates for d1i6wa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i6wa_:
- d1i6wa_ first appeared in SCOP 1.57
- d1i6wa_ appears in SCOPe 2.06
- d1i6wa_ appears in the current release, SCOPe 2.08
View in 3D
