Lineage for d1i6ia_ (1i6i A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696444Family c.37.1.9: Motor proteins [52641] (4 proteins)
  6. 696445Protein Kinesin [52646] (7 species)
  7. 696482Species Mouse (Mus musculus), kif1a [TaxId:10090] [64017] (7 PDB entries)
  8. 696484Domain d1i6ia_: 1i6i A: [61844]
    complexed with acp, mg, trs; mutant

Details for d1i6ia_

PDB Entry: 1i6i (more details), 2 Å

PDB Description: crystal structure of the kif1a motor domain complexed with mg-amppcp
PDB Compounds: (A:) Kinesin-like protein KIF1A

SCOP Domain Sequences for d1i6ia_:

Sequence, based on SEQRES records: (download)

>d1i6ia_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]}
gasvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtsp
edinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipql
cedlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedls
klavtsyndiqdlmdsgnkartvaatnmnetssrshavfniiftqkrhdaetnittekvs
kislvdlagseradstgakgtrlkeganinkslttlgkvisalaemdsgpnknkkkkktd
fipyrdsvltwllrenlggnsrtamvaalspadinydetlstlryadrakqirntvsvnh
hhhh

Sequence, based on observed residues (ATOM records): (download)

>d1i6ia_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]}
gasvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtsp
edinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipql
cedlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedls
klavtsyndiqdlmdsgnkartvaatnmnetssrshavfniiftqkrhdaetnittekvs
kislvdlagseaninkslttlgkvisalaemdfipyrdsvltwllrenlggnsrtamvaa
lspadinydetlstlryadrakqirntvhhhhh

SCOP Domain Coordinates for d1i6ia_:

Click to download the PDB-style file with coordinates for d1i6ia_.
(The format of our PDB-style files is described here.)

Timeline for d1i6ia_: