Lineage for d1i53a_ (1i53 A:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding siteFamily b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
mono-domain proteins
Protein Azurin [49530] (6 species) Species Pseudomonas aeruginosa [TaxId:287] [49533] (78 PDB entries)
Uniprot P00282
Domain d1i53a_: 1i53 A: [66031]
complexed with cu, dpt, rtc
Details for d1i53a_
PDB Entry: 1i53 (more details), 1.8 Å
PDB Description: re(i)-tricarbonyl diimine (q107h)) azurin
PDB Compounds: (A:) AzurinSCOPe Domain Sequences for d1i53a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i53a_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegehymffctfpghsal
mkgtltlk
SCOPe Domain Coordinates for d1i53a_:
Click to download the PDB-style file with coordinates for d1i53a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i53a_:
- d1i53a_ first appeared in SCOP 1.59
- d1i53a_ appears in SCOPe 2.02
- d1i53a_ appears in SCOPe 2.04
- d1i53a_ appears in the current release, SCOPe 2.08
View in 3D
