Lineage for d1i4pa2 (1i4p A:121-239)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) 
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) 
Protein Staphylococcal enterotoxin C2, SEC2 [54338] (1 species) Species Staphylococcus aureus [TaxId:1280] [54339] (8 PDB entries) 
Domain d1i4pa2: 1i4p A:121-239 [61724]
Other proteins in same PDB: d1i4pa1
complexed with zn
Details for d1i4pa2
PDB Entry: 1i4p (more details), 2 Å
PDB Description: crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.5
PDB Compounds: (A:) enterotoxin type c-2SCOPe Domain Sequences for d1i4pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4pa2 d.15.6.1 (A:121-239) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
SCOPe Domain Coordinates for d1i4pa2:
Click to download the PDB-style file with coordinates for d1i4pa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i4pa2:
- d1i4pa2 first appeared in SCOP 1.57
- d1i4pa2 appears in SCOPe 2.04
- d1i4pa2 appears in SCOPe 2.06
- d1i4pa2 appears in the current release, SCOPe 2.08
View in 3D
