Lineage for d1i4pa1 (1i4p A:1-120)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-keySuperfamily b.40.2: Bacterial enterotoxins [50203] (3 families) 
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) 
Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species) Species Staphylococcus aureus [TaxId:1280] [50223] (8 PDB entries) 
Domain d1i4pa1: 1i4p A:1-120 [61723]
Other proteins in same PDB: d1i4pa2
complexed with zn
Details for d1i4pa1
PDB Entry: 1i4p (more details), 2 Å
PDB Description: crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.5
PDB Compounds: (A:) enterotoxin type c-2SCOPe Domain Sequences for d1i4pa1:
Sequence, based on SEQRES records: (download)
>d1i4pa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
Sequence, based on observed residues (ATOM records): (download)
>d1i4pa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnggktcmyggitkheg
SCOPe Domain Coordinates for d1i4pa1:
Click to download the PDB-style file with coordinates for d1i4pa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i4pa1:
- d1i4pa1 first appeared in SCOP 1.57
- d1i4pa1 appears in SCOPe 2.06
- d1i4pa1 appears in the current release, SCOPe 2.08
View in 3D
