Lineage for d1i45a_ (1i45 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
automatically mapped to Pfam PF00121Protein Triosephosphate isomerase [51353] (20 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51356] (8 PDB entries) 
Domain d1i45a_: 1i45 A: [61665]
mutant
Details for d1i45a_
PDB Entry: 1i45 (more details), 1.8 Å
PDB Description: yeast triosephosphate isomerase (mutant)
PDB Compounds: (A:) triosephosphate isomeraseSCOPe Domain Sequences for d1i45a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i45a_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
gaqnaylkasgaftgensvdqikdvgakyvilghserrsyfheddkfiadktkfalgqgv
gvilcigetleekkagktldvverqlnavleevkdftnvvvayepvwaigtglaatpeda
qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
diinsrn
SCOPe Domain Coordinates for d1i45a_:
Click to download the PDB-style file with coordinates for d1i45a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i45a_:
- d1i45a_ first appeared in SCOP 1.57
- d1i45a_ appears in SCOPe 2.04
- d1i45a_ appears in SCOPe 2.06
- d1i45a_ appears in the current release, SCOPe 2.08
View in 3D
