| Class g: Small proteins [56992] (85 folds) |
| Fold g.41: Rubredoxin-like [57769] (16 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) ![]() |
| Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins) |
| Protein RBP9 subunit of RNA polymerase II [57787] (2 species) contains two differently decorated domains of this fold |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) |
| Domain d1i3qi2: 1i3q I:50-122 [61616] Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qj_, d1i3qk_, d1i3ql_ complexed with mg, zn |
PDB Entry: 1i3q (more details), 3.1 Å
SCOP Domain Sequences for d1i3qi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3qi2 g.41.3.1 (I:50-122) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtqfs
Timeline for d1i3qi2: