Lineage for d1i3qc1 (1i3q C:3-41,C:173-268)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209032Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1209136Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 1209137Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 1209190Protein RPB3 [64315] (1 species)
  7. 1209191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 1209195Domain d1i3qc1: 1i3q C:3-41,C:173-268 [61609]
    Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3qk_, d1i3ql_
    protein/RNA complex; complexed with mg, zn

Details for d1i3qc1

PDB Entry: 1i3q (more details), 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution
PDB Compounds: (C:) DNA-directed RNA polymerase II 45kd polypeptide

SCOPe Domain Sequences for d1i3qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3qc1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw
yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq
kkvasillaltqmdqd

SCOPe Domain Coordinates for d1i3qc1:

Click to download the PDB-style file with coordinates for d1i3qc1.
(The format of our PDB-style files is described here.)

Timeline for d1i3qc1: