Lineage for d1i2na_ (1i2n A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.10: Aldolase [51569] (9 families) 
Common fold covers whole protein structureFamily c.1.10.1: Class I aldolase [51570] (13 proteins)
the catalytic lysine forms schiff-base intermediate with substrate
possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
Protein Transaldolase [51588] (3 species)
probably related to class I aldolases by a circular permutationSpecies Escherichia coli [TaxId:562] [51589] (7 PDB entries) 
Domain d1i2na_: 1i2n A: [61572]
mutant
Details for d1i2na_
PDB Entry: 1i2n (more details), 2.05 Å
PDB Description: crystal structure of escherichia coli transaldolase b mutant n35a
PDB Compounds: (A:) transaldolase bSCOPe Domain Sequences for d1i2na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i2na_ c.1.10.1 (A:) Transaldolase {Escherichia coli [TaxId: 562]}
tdkltslrqyttvvadtgdiaamklyqpqdattapslilnaaqipeyrkliddavawakq
qsndraqqivdatdklavnigleilklvpgristevdarlsydteasiakakrliklynd
agisndriliklastwqgiraaeqlekegincnltllfsfaqaracaeagvflispfvgr
ildwykantdkkeyapaedpgvvsvseiyqyykehgyetvvmgasfrnigeilelagcdr
ltiapallkelaesegaierklsytgevkarpariteseflwqhnqdpmavdklaegirk
faidqeklekmigdll
SCOPe Domain Coordinates for d1i2na_:
Click to download the PDB-style file with coordinates for d1i2na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i2na_:
- d1i2na_ first appeared in SCOP 1.57
- d1i2na_ appears in SCOPe 2.06
- d1i2na_ appears in the current release, SCOPe 2.08
View in 3D
