Lineage for d1i19a2 (1i19 A:57-273)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987461Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)
  6. Protein Cholesterol oxidase [64414] (1 species)
  7. Species Brevibacterium sterolicum [TaxId:1702] [64415] (1 PDB entry)
  8. 2987479Domain d1i19a2: 1i19 A:57-273 [61523]
    Other proteins in same PDB: d1i19a1, d1i19b1
    complexed with cac, edo, fad, mn

Details for d1i19a2

PDB Entry: 1i19 (more details), 1.7 Å

PDB Description: crystal structure of cholesterol oxidase from b.sterolicum
PDB Compounds: (A:) cholesterol oxidase

SCOPe Domain Sequences for d1i19a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i19a2 d.145.1.1 (A:57-273) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]}
vaplptppnfpndialfqqayqnwskeimldatwvcspktpqdvvrlanwahehdykirp
rgamhgwtpltvekganvekviladtmthlngitvntggpvatvtagagasieaivtelq
khdlgwanlpapgvlsiggalavnahgaalpavgqttlpghtygslsnlvteltavvwng
ttyaletyqrndpritplltnlgrcfltsvtmqagpn

SCOPe Domain Coordinates for d1i19a2:

Click to download the PDB-style file with coordinates for d1i19a2.
(The format of our PDB-style files is described here.)

Timeline for d1i19a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i19a1