Lineage for d1i19a1 (1i19 A:274-613)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562051Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2562108Family d.58.32.3: Cholesterol oxidase [64284] (2 proteins)
    automatically mapped to Pfam PF09129
  6. Protein Cholesterol oxidase [64285] (1 species)
  7. Species Brevibacterium sterolicum [TaxId:1702] [64286] (1 PDB entry)
  8. 2562111Domain d1i19a1: 1i19 A:274-613 [61522]
    Other proteins in same PDB: d1i19a2, d1i19b2
    complexed with cac, edo, fad, mn

Details for d1i19a1

PDB Entry: 1i19 (more details), 1.7 Å

PDB Description: crystal structure of cholesterol oxidase from b.sterolicum
PDB Compounds: (A:) cholesterol oxidase

SCOPe Domain Sequences for d1i19a1:

Sequence, based on SEQRES records: (download)

>d1i19a1 d.58.32.3 (A:274-613) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]}
frqrcqsytdipwrelfapkgadgrtfekfvaesggaeaiwypftekpwmkvwtvsptkp
dssnevgslgsagslvgkppqarevsgpynyifsdnlpepitdmigainagnpgiaplfg
pamyeitklglaatnandiwgwskdvqfyikattlrltegggavvtsraniatvindfte
wfheriefyrakgefplngpveirccgldqaadvkvpsvgpptisatrprpdhpdwdvai
wlnvlgvpgtpgmfefyremeqwmrshynnddatfrpewskgwafgpdpytdndivtnkm
ratyiegvpttenwdtararynqidphrvftngfmdkllp

Sequence, based on observed residues (ATOM records): (download)

>d1i19a1 d.58.32.3 (A:274-613) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]}
frqrcqsytdipwrelfapkgadgrtfekfvaesggaeaiwypftekpwmkvwtvspslv
gkppqarevsgpynyifsdnlpepitdmigainagnpgiaplfgpamyeitklglaatna
ndiwgwskdvqfyikattlrltegggavvtsraniatvindftewfheriefyrakgefp
lngpveirccgldqaadvkvpsvgpptisatrprpdhpdwdvaiwlnvlgvpgtpgmfef
yremeqwmrshynnddatfrpewskgwafgpdpytdndivtnkmratyiegvpttenwdt
ararynqidphrvftngfmdkllp

SCOPe Domain Coordinates for d1i19a1:

Click to download the PDB-style file with coordinates for d1i19a1.
(The format of our PDB-style files is described here.)

Timeline for d1i19a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i19a2