Lineage for d1i0da_ (1i0d A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrelFamily c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
automatically mapped to Pfam PF02126Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (4 species) Species Pseudomonas diminuta [TaxId:293] [51566] (23 PDB entries)
Uniprot P0A434 30-365
Domain d1i0da_: 1i0d A: [61487]
complexed with cd, edo, fmt, na, pel, zn
Details for d1i0da_
PDB Entry: 1i0d (more details), 1.3 Å
PDB Description: high resolution structure of the zinc/cadmium-containing phosphotriesterase from pseudomonas diminuta
PDB Compounds: (A:) phosphotriesteraseSCOPe Domain Sequences for d1i0da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgi
rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpqetlagitvtnparflsptlras
SCOPe Domain Coordinates for d1i0da_:
Click to download the PDB-style file with coordinates for d1i0da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i0da_:
- d1i0da_ first appeared in SCOP 1.57
- d1i0da_ appears in SCOPe 2.05
- d1i0da_ appears in SCOPe 2.07
- d1i0da_ appears in the current release, SCOPe 2.08
View in 3D
