Lineage for d1hzwa_ (1hzw A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) 
automatically mapped to Pfam PF00303Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) 
Protein Thymidylate synthase [55833] (7 species) 
Species Human (Homo sapiens) [TaxId:9606] [55840] (47 PDB entries) 
Domain d1hzwa_: 1hzw A: [61464]
complexed with po4
Details for d1hzwa_
PDB Entry: 1hzw (more details), 2 Å
PDB Description: crystal structure of human thymidylate synthase
PDB Compounds: (A:) Thymidylate synthaseSCOPe Domain Sequences for d1hzwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzwa_ d.117.1.1 (A:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
gselqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvlee
llwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyr
dmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnse
lscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplki
qlqreprpfpklrilrkvekiddfkaedfqiegynphpti
SCOPe Domain Coordinates for d1hzwa_:
Click to download the PDB-style file with coordinates for d1hzwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hzwa_:
- d1hzwa_ first appeared in SCOP 1.57
- d1hzwa_ appears in SCOPe 2.07
View in 3D
