Lineage for d1hzaa_ (1hza A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
barrel, closed; n=5, S=8
Protein Major cold shock protein [50283] (4 species) 
Species Bacillus caldolyticus [TaxId:1394] [50286] (8 PDB entries) 
Domain d1hzaa_: 1hza A: [65963]
mutant
Details for d1hzaa_
PDB Entry: 1hza (more details), 1.8 Å
PDB Description: bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
PDB Compounds: (A:) Cold shock protein cspBSCOPe Domain Sequences for d1hzaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzaa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvtkea
SCOPe Domain Coordinates for d1hzaa_:
Click to download the PDB-style file with coordinates for d1hzaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hzaa_:
- d1hzaa_ first appeared in SCOP 1.59
- d1hzaa_ appears in SCOPe 2.07
View in 3D
