Class g: Small proteins [56992] (100 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (6 proteins) |
Protein Eea1 [64583] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64584] (3 PDB entries) |
Domain d1hyja_: 1hyj A: [61407] complexed with zn |
PDB Entry: 1hyj (more details)
SCOPe Domain Sequences for d1hyja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hyja_ g.50.1.1 (A:) Eea1 {Human (Homo sapiens) [TaxId: 9606]} rkwaednevqncmacgkgfsvtvrrhhcrqcgnifcaecsaknaltpsskkpvrvcdacf ndlqg
Timeline for d1hyja_: