Lineage for d1hyja_ (1hyj A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037864Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (6 proteins)
  6. 3037865Protein Eea1 [64583] (1 species)
  7. 3037866Species Human (Homo sapiens) [TaxId:9606] [64584] (3 PDB entries)
  8. 3037869Domain d1hyja_: 1hyj A: [61407]
    complexed with zn

Details for d1hyja_

PDB Entry: 1hyj (more details)

PDB Description: solution structure of the eea1 fyve domain
PDB Compounds: (A:) endosome-associated protein

SCOPe Domain Sequences for d1hyja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyja_ g.50.1.1 (A:) Eea1 {Human (Homo sapiens) [TaxId: 9606]}
rkwaednevqncmacgkgfsvtvrrhhcrqcgnifcaecsaknaltpsskkpvrvcdacf
ndlqg

SCOPe Domain Coordinates for d1hyja_:

Click to download the PDB-style file with coordinates for d1hyja_.
(The format of our PDB-style files is described here.)

Timeline for d1hyja_: