Lineage for d1hxza_ (1hxz A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.61: Streptavidin-like [50875] (8 superfamilies)
barrel, closed; n=8, S=10; meanderSuperfamily b.61.1: Avidin/streptavidin [50876] (2 families) 
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) Protein Streptavidin [50878] (1 species) Species Streptomyces avidinii [TaxId:1895] [50879] (125 PDB entries) 
Domain d1hxza_: 1hxz A: [83649]
complexed with miniprotein MP-2, chains C and D
Details for d1hxza_
PDB Entry: 1hxz (more details), 1.8 Å
PDB Description: miniprotein mp-2 complex with streptavidin
PDB Compounds: (A:) streptavidinSCOPe Domain Sequences for d1hxza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxza_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v
SCOPe Domain Coordinates for d1hxza_:
Click to download the PDB-style file with coordinates for d1hxza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hxza_:
- d1hxza_ first appeared in SCOP 1.65
- d1hxza_ appears in SCOPe 2.05
- d1hxza_ appears in SCOPe 2.07
- d1hxza_ appears in the current release, SCOPe 2.08
View in 3D
