Lineage for d1hxga1 (1hxg A:15-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722507Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins)
    incomplete toroid made of four hairpins
    automatically mapped to Pfam PF01397
  6. 2722523Protein 5-Epi-aristolochene synthase [48241] (1 species)
  7. 2722524Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48242] (7 PDB entries)
  8. 2722528Domain d1hxga1: 1hxg A:15-220 [83645]
    Other proteins in same PDB: d1hxga2
    complexed with mg

Details for d1hxga1

PDB Entry: 1hxg (more details), 2.9 Å

PDB Description: crystal structure of teas w273s/c440w
PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d1hxga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxga1 a.102.4.1 (A:15-220) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
rpvadfspslwgdqflsfsidnqvaekyakeiealkeqtrnmllatgmkladtlnlidti
erlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdeng
kfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthal
eqclhkgvprvetrffissiydkeqs

SCOPe Domain Coordinates for d1hxga1:

Click to download the PDB-style file with coordinates for d1hxga1.
(The format of our PDB-style files is described here.)

Timeline for d1hxga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hxga2