Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Bacterial alpha-amylase [51447] (10 species) |
Species Bacillus stearothermophilus [TaxId:1422] [51451] (1 PDB entry) |
Domain d1hvxa2: 1hvx A:1-393 [28708] Other proteins in same PDB: d1hvxa1 complexed with ca, na |
PDB Entry: 1hvx (more details), 2 Å
SCOPe Domain Sequences for d1hvxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} aapfngtmmqyfewylpddgtlwtkvaneannlsslgitalwlppaykgtsrsdvgygvy dlydlgefnqkgavrtkygtkaqylqaiqaahaagmqvyadvvfdhkggadgtewvdave vnpsdrnqeisgtyqiqawtkfdfpgrgntyssfkwrwyhfdgvdwdesrklsriykfrg igkawdwevdtengnydylmyadldmdhpevvtelkswgkwyvnttnidgfrldavkhik fsffpdwlsyvrsqtgkplftvgeywsydinklhnyimktngtmslfdaplhnkfytask sggtfdmrtlmtntlmkdqptlavtfvdnhdtepgqalqswvdpwfkplayafiltrqeg ypcvfygdyygipqynipslkskidplliarrd
Timeline for d1hvxa2: