Lineage for d1hvsa_ (1hvs A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (4 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
dimer of identical mono-domain chains, each containing (6,10) barrelProtein Human immunodeficiency virus type 1 protease [50632] (8 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
Domain d1hvsa_: 1hvs A: [26597]
complexed with a77; mutant
Details for d1hvsa_
PDB Entry: 1hvs (more details), 2.25 Å
PDB Description: structural basis of drug resistance for the v82a mutant of hiv-1 protease: backbone flexibility and subsite repacking
PDB Compounds: (A:) hiv-1 proteaseSCOPe Domain Sequences for d1hvsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hvsa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpaniigrnlltqigctlnf
SCOPe Domain Coordinates for d1hvsa_:
Click to download the PDB-style file with coordinates for d1hvsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hvsa_:
- d1hvsa_ first appeared (with stable ids) in SCOP 1.55
- d1hvsa_ appears in SCOPe 2.04
- d1hvsa_ appears in SCOPe 2.06
- d1hvsa_ appears in the current release, SCOPe 2.08
View in 3D
