Lineage for d1hv9b1 (1hv9 B:252-452)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423278Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423279Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2423460Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 2423475Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (3 species)
  7. 2423476Species Escherichia coli [TaxId:562] [51173] (6 PDB entries)
  8. 2423482Domain d1hv9b1: 1hv9 B:252-452 [28061]
    Other proteins in same PDB: d1hv9a2, d1hv9b2
    complexed with co, coa, ud1

Details for d1hv9b1

PDB Entry: 1hv9 (more details), 2.1 Å

PDB Description: structure of e. coli glmu: analysis of pyrophosphorylase and acetyltransferase active sites
PDB Compounds: (B:) udp-n-acetylglucosamine pyrophosphorylase

SCOPe Domain Sequences for d1hv9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv9b1 b.81.1.4 (B:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskaghltylgdae
igdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatiaagttvtrnv
genalaisrvpqtqkegwrrp

SCOPe Domain Coordinates for d1hv9b1:

Click to download the PDB-style file with coordinates for d1hv9b1.
(The format of our PDB-style files is described here.)

Timeline for d1hv9b1:

2423482
d1hv9b1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1hv9b2