Lineage for d1hv8a2 (1hv8 A:211-365)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870844Protein Putative DEAD box RNA helicase [52704] (1 species)
    homologous to eIF4a and UvrB
  7. 2870845Species Methanococcus jannaschii [TaxId:2190] [52705] (1 PDB entry)
  8. 2870847Domain d1hv8a2: 1hv8 A:211-365 [32406]
    complexed with so4

Details for d1hv8a2

PDB Entry: 1hv8 (more details), 3 Å

PDB Description: crystal structure of a dead box protein from the hyperthermophile methanococcus jannaschii
PDB Compounds: (A:) putative ATP-dependent RNA helicase mj0669

SCOPe Domain Sequences for d1hv8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Methanococcus jannaschii [TaxId: 2190]}
nanieqsyvevnenerfealcrllknkefyglvfcktkrdtkelasmlrdigfkagaihg
dlsqsqrekvirlfkqkkiriliatdvmsrgidvndlncvinyhlpqnpesymhrigrtg
ragkkgkaisiinrreykklryieramklkikklk

SCOPe Domain Coordinates for d1hv8a2:

Click to download the PDB-style file with coordinates for d1hv8a2.
(The format of our PDB-style files is described here.)

Timeline for d1hv8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hv8a1