Lineage for d1huwa_ (1huw A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767022Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 767023Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 767024Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 767050Protein Growth hormone, somatotropin [47276] (1 species)
  7. 767051Species Human (Homo sapiens) [TaxId:9606] [47277] (9 PDB entries)
  8. 767052Domain d1huwa_: 1huw A: [16831]
    mutant

Details for d1huwa_

PDB Entry: 1huw (more details), 2 Å

PDB Description: the crystal structure of affinity-matured human growth hormone at 2 angstroms resolution
PDB Compounds: (A:) human growth hormone

SCOP Domain Sequences for d1huwa_:

Sequence, based on SEQRES records: (download)

>d1huwa_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens) [TaxId: 9606]}
fptiplsrladnawlradrlnqlafdtyqefeeayipkeqihsfwwnpqtslcpsesipt
psnkeetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeg
iqtlmgrledgsprtgqifkqtyskfdtnshnddallknygllycfnkdmskvstylrtv
qcrsvegscgf

Sequence, based on observed residues (ATOM records): (download)

>d1huwa_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens) [TaxId: 9606]}
fptiplsrladnawlradrlnqlafdtyqefeeayipkeqihsfwwnpqtslcpsesipt
psnkeetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeg
iqtlmgrleallknygllycfnkdmskvstylrtvqcrsvegscgf

SCOP Domain Coordinates for d1huwa_:

Click to download the PDB-style file with coordinates for d1huwa_.
(The format of our PDB-style files is described here.)

Timeline for d1huwa_: