Lineage for d1hura_ (1hur A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1163639Protein ADP-ribosylation factor [52614] (15 species)
  7. 1163647Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (9 PDB entries)
    Uniprot P32889
  8. 1163661Domain d1hura_: 1hur A: [32052]
    complexed with gdp, mg

Details for d1hura_

PDB Entry: 1hur (more details), 2 Å

PDB Description: human adp-ribosylation factor 1 complexed with gdp, full length non-myristoylated
PDB Compounds: (A:) human ADP-ribosylation factor 1

SCOPe Domain Sequences for d1hura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hura_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

SCOPe Domain Coordinates for d1hura_:

Click to download the PDB-style file with coordinates for d1hura_.
(The format of our PDB-style files is described here.)

Timeline for d1hura_: