Lineage for d1htya1 (1hty A:412-522)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764262Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 764309Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (3 families) (S)
  5. 764310Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 764311Protein Golgi alpha-mannosidase II [88694] (1 species)
  7. 764312Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (46 PDB entries)
    Uniprot Q24451 94-1107
  8. 764333Domain d1htya1: 1hty A:412-522 [83064]
    Other proteins in same PDB: d1htya2, d1htya3
    complexed with mpd, nag, trs, zn

Details for d1htya1

PDB Entry: 1hty (more details), 1.4 Å

PDB Description: golgi alpha-mannosidase ii
PDB Compounds: (A:) Alpha-mannosidase II

SCOP Domain Sequences for d1htya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htya1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs

SCOP Domain Coordinates for d1htya1:

Click to download the PDB-style file with coordinates for d1htya1.
(The format of our PDB-style files is described here.)

Timeline for d1htya1: