SCOP 1.75: Domain d1htoa1: 1hto A:1-100

Lineage for d1htoa1 (1hto A:1-100)

Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family)
Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
Species Mycobacterium tuberculosis [TaxId:1773] [75372] (3 PDB entries)

Domain d1htoa1: 1hto A:1-100 [70987]
Other proteins in same PDB: d1htoa2, d1htob2, d1htoc2, d1htod2, d1htoe2, d1htof2, d1htog2, d1htoh2, d1htoi2, d1htoj2, d1htok2, d1htol2, d1htom2, d1hton2, d1htoo2, d1htop2, d1htoq2, d1htor2, d1htos2, d1htot2, d1htou2, d1htov2, d1htow2, d1htox2

Details for d1htoa1

PDB Entry: 1hto (more details), 2.4 Å

PDB Description: crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis

PDB Compounds: (A:) glutamine synthetase

SCOP Domain Sequences for d1htoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htoa1 d.15.9.1 (A:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOP Domain Coordinates for d1htoa1:

Click to download the PDB-style file with coordinates for d1htoa1.
(The format of our PDB-style files is described here.)

Timeline for d1htoa1:

d1htoa1 first appeared in SCOP 1.61
d1htoa1 appears in SCOP 1.73
d1htoa1 appears in SCOPe 2.01
d1htoa1 appears in the current release, SCOPe 2.08

Thumbnails for d1htoa1:

d1htoa1
(click for larger image)

View in 3D

d1htoa1 in context of chain

View in 3D
Domains from same chain:
(mouse over for more information)
d1htoa2

d1htoa1 in context of PDB

View in 3D
Domains from other chains:
(mouse over for more information)
d1htob1, d1htob2, d1htoc1, d1htoc2, d1htod1, d1htod2, d1htoe1, d1htoe2, d1htof1, d1htof2, d1htog1, d1htog2, d1htoh1, d1htoh2, d1htoi1, d1htoi2, d1htoj1, d1htoj2, d1htok1, d1htok2, d1htol1, d1htol2, d1htom1, d1htom2, d1hton1, d1hton2, d1htoo1, d1htoo2, d1htop1, d1htop2, d1htoq1, d1htoq2, d1htor1, d1htor2, d1htos1, d1htos2, d1htot1, d1htot2, d1htou1, d1htou2, d1htov1, d1htov2, d1htow1, d1htow2, d1htox1, d1htox2