Lineage for d1htoa1 (1hto A:1-100)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 718125Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 718126Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 718127Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 718128Species Mycobacterium tuberculosis [TaxId:1773] [75372] (3 PDB entries)
  8. 718159Domain d1htoa1: 1hto A:1-100 [70987]
    Other proteins in same PDB: d1htoa2, d1htob2, d1htoc2, d1htod2, d1htoe2, d1htof2, d1htog2, d1htoh2, d1htoi2, d1htoj2, d1htok2, d1htol2, d1htom2, d1hton2, d1htoo2, d1htop2, d1htoq2, d1htor2, d1htos2, d1htot2, d1htou2, d1htov2, d1htow2, d1htox2

Details for d1htoa1

PDB Entry: 1hto (more details), 2.4 Å

PDB Description: crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
PDB Compounds: (A:) glutamine synthetase

SCOP Domain Sequences for d1htoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htoa1 d.15.9.1 (A:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOP Domain Coordinates for d1htoa1:

Click to download the PDB-style file with coordinates for d1htoa1.
(The format of our PDB-style files is described here.)

Timeline for d1htoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htoa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1htob1, d1htob2, d1htoc1, d1htoc2, d1htod1, d1htod2, d1htoe1, d1htoe2, d1htof1, d1htof2, d1htog1, d1htog2, d1htoh1, d1htoh2, d1htoi1, d1htoi2, d1htoj1, d1htoj2, d1htok1, d1htok2, d1htol1, d1htol2, d1htom1, d1htom2, d1hton1, d1hton2, d1htoo1, d1htoo2, d1htop1, d1htop2, d1htoq1, d1htoq2, d1htor1, d1htor2, d1htos1, d1htos2, d1htot1, d1htot2, d1htou1, d1htou2, d1htov1, d1htov2, d1htow1, d1htow2, d1htox1, d1htox2