Lineage for d1htjf_ (1htj F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741165Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1741166Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1741167Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 1741189Protein Pdz-RhoGEF RGS-like domain [63586] (1 species)
    contains extra helices in the C-terminal extension
  7. 1741190Species Human (Homo sapiens) [TaxId:9606] [63587] (1 PDB entry)
  8. 1741191Domain d1htjf_: 1htj F: [61254]

Details for d1htjf_

PDB Entry: 1htj (more details), 2.2 Å

PDB Description: structure of the rgs-like domain from pdz-rhogef
PDB Compounds: (F:) kiaa0380

SCOPe Domain Sequences for d1htjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htjf_ a.91.1.1 (F:) Pdz-RhoGEF RGS-like domain {Human (Homo sapiens) [TaxId: 9606]}
esdiifqdleklksrpahlgvflryifsqadpspllfylcaevyqqaspkdsrslgkdiw
nifleknaplrvkipemlqaeidsrlrnsedargvlceaqeaampeiqeqihdyrtkrtl
glgslygendlldldgdplrerqvaekqlaalgdilsayaadrsapmdfalntymshagi
rl

SCOPe Domain Coordinates for d1htjf_:

Click to download the PDB-style file with coordinates for d1htjf_.
(The format of our PDB-style files is described here.)

Timeline for d1htjf_: