Lineage for d1hsla_ (1hsl A:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topologyFamily c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) 
Protein Histidine-binding protein [53872] (2 species) Species Escherichia coli [TaxId:562] [53873] (1 PDB entry) 
Domain d1hsla_: 1hsl A: [35804]
complexed with cd, his
Details for d1hsla_
PDB Entry: 1hsl (more details), 1.89 Å
PDB Description: refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors
PDB Compounds: (A:) histidine-binding proteinSCOPe Domain Sequences for d1hsla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hsla_ c.94.1.1 (A:) Histidine-binding protein {Escherichia coli [TaxId: 562]}
aipqkirigtdptyapfesknaqgelvgfdidlakelckrintqctfvenpldalipslk
akkidaimsslsitekrqqeiaftdklyaadsrlvvaknsdiqptvaslkgkrvgvlqgt
tqetfgnehwapkgieivsyqgqdniysdltagridaafqdevaasegflkqpvgkdykf
ggpavkdeklfgvgtgmglrkednelrealnkafaemradgtyeklakkyfdfdvygg
SCOPe Domain Coordinates for d1hsla_:
Click to download the PDB-style file with coordinates for d1hsla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hsla_:
- d1hsla_ first appeared (with stable ids) in SCOP 1.55
- d1hsla_ appears in SCOPe 2.02
- d1hsla_ appears in SCOPe 2.04
- d1hsla_ appears in the current release, SCOPe 2.08
View in 3D
