Lineage for d1hrya_ (1hry A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987159Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1987160Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1987161Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 1987211Protein SRY [47104] (1 species)
  7. 1987212Species Human (Homo sapiens) [TaxId:9606] [47105] (5 PDB entries)
  8. 1987216Domain d1hrya_: 1hry A: [16429]
    protein/DNA complex

Details for d1hrya_

PDB Entry: 1hry (more details)

PDB Description: the 3d structure of the human sry-dna complex solved by multid- dimensional heteronuclear-edited and-filtered nmr
PDB Compounds: (A:) human sry

SCOPe Domain Sequences for d1hrya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrya_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]}
drvkrpmnafivwsrdqrrkmalenprmrnseiskqlgyqwkmlteaekwpffqeaqklq
amhrekypnykyr

SCOPe Domain Coordinates for d1hrya_:

Click to download the PDB-style file with coordinates for d1hrya_.
(The format of our PDB-style files is described here.)

Timeline for d1hrya_: