Lineage for d1hqsa_ (1hqs A:)
- Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
consists of two intertwined (sub)domains related by pseudo dyad; duplication
3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the restSuperfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) 
the constituent families form similar dimersFamily c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
the active site is between the two identical subunitsProtein Isocitrate dehydrogenase, ICDH [53668] (2 species) Species Bacillus subtilis [TaxId:1423] [64171] (1 PDB entry) 
Domain d1hqsa_: 1hqs A: [61154]
complexed with cit, pgo, pgr
Details for d1hqsa_
PDB Entry: 1hqs (more details), 1.55 Å
PDB Description: crystal structure of isocitrate dehydrogenase from bacillus subtilis
PDB Compounds: (A:) isocitrate dehydrogenaseSCOPe Domain Sequences for d1hqsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqsa_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Bacillus subtilis [TaxId: 1423]}
maqgekitvsngvlnvpnnpiipfiegdgtgpdiwnaaskvleaavekaykgekkitwke
vyagekaynktgewlpaetldvireyfiaikgplttpvgggirslnvalrqeldlfvclr
pvryftgvpspvkrpedtdmvifrentediyagieyakgseevqklisflqnelnvnkir
fpetsgigikpvseegtsrlvraaidyaiehgrksvtlvhkgnimkftegafknwgyela
ekeygdkvftwaqydriaeeqgkdaankaqseaeaagkiiikdsiadiflqqiltrpnef
dvvatmnlngdyisdalaaqvggigiapganinyetghaifeathgtapkyagldkvnps
svilsgvlllehlgwneaadlviksmektiaskvvtydfarlmdgatevkcsefgeelik
nmd
SCOPe Domain Coordinates for d1hqsa_:
Click to download the PDB-style file with coordinates for d1hqsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hqsa_:
- d1hqsa_ first appeared in SCOP 1.57
- d1hqsa_ appears in SCOPe 2.01
- d1hqsa_ appears in SCOPe 2.03
- d1hqsa_ appears in the current release, SCOPe 2.08
View in 3D
