Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily) corner-like structure formed by two sheets and filled in with 2-3 helices |
Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold |
Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins) note: the solution structure determinations disagree in the relative orientations of two motifs |
Protein Phenol hydroxylase P2 protein [56034] (1 species) |
Species Pseudomonas sp., CF600 [TaxId:306] [56035] (1 PDB entry) |
Domain d1hqia_: 1hqi A: [41454] this structure is probably incorrect, as its secondary structure elements are loosely packed |
PDB Entry: 1hqi (more details)
SCOPe Domain Sequences for d1hqia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqia_ d.137.1.1 (A:) Phenol hydroxylase P2 protein {Pseudomonas sp., CF600 [TaxId: 306]} msslvyiafqdndnaryvveaiiqdnphavvqhhpamirieaekrleirretveenlgra wdvqemlvdvitiggnvdedddrfvlewkn
Timeline for d1hqia_: