Lineage for d1hqia_ (1hqi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978075Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2978076Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2978077Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2978078Protein Phenol hydroxylase P2 protein [56034] (1 species)
  7. 2978079Species Pseudomonas sp., CF600 [TaxId:306] [56035] (1 PDB entry)
  8. 2978080Domain d1hqia_: 1hqi A: [41454]
    this structure is probably incorrect, as its secondary structure elements are loosely packed

Details for d1hqia_

PDB Entry: 1hqi (more details)

PDB Description: component p2 from the multicomponent phenol hydroxylase, nmr, 11 structures
PDB Compounds: (A:) phenol hydroxylase p2 protein

SCOPe Domain Sequences for d1hqia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqia_ d.137.1.1 (A:) Phenol hydroxylase P2 protein {Pseudomonas sp., CF600 [TaxId: 306]}
msslvyiafqdndnaryvveaiiqdnphavvqhhpamirieaekrleirretveenlgra
wdvqemlvdvitiggnvdedddrfvlewkn

SCOPe Domain Coordinates for d1hqia_:

Click to download the PDB-style file with coordinates for d1hqia_.
(The format of our PDB-style files is described here.)

Timeline for d1hqia_: