Lineage for d1hqfa_ (1hqf A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 832711Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 832712Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 832713Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins)
    Pfam PF00491
  6. 832734Protein Arginase [52770] (5 species)
  7. 832790Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (31 PDB entries)
    Uniprot P07824
  8. 832869Domain d1hqfa_: 1hqf A: [61133]

Details for d1hqfa_

PDB Entry: 1hqf (more details), 2.9 Å

PDB Description: crystal structure of the binuclear manganese metalloenzyme arginase complexed with n-hydroxy-l-arginine
PDB Compounds: (A:) arginase 1

SCOP Domain Sequences for d1hqfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqfa_ c.42.1.1 (A:) Arginase {Rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

SCOP Domain Coordinates for d1hqfa_:

Click to download the PDB-style file with coordinates for d1hqfa_.
(The format of our PDB-style files is described here.)

Timeline for d1hqfa_: