Lineage for d1hova_ (1hov A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964524Protein MMP-2 [69778] (1 species)
  7. 2964525Species Human (Homo sapiens) [TaxId:9606] [69779] (1 PDB entry)
  8. 2964526Domain d1hova_: 1hov A: [65897]
    complexed with ca, i52, zn

Details for d1hova_

PDB Entry: 1hov (more details)

PDB Description: solution structure of a catalytic domain of mmp-2 complexed with sc- 74020
PDB Compounds: (A:) matrix metalloproteinase-2

SCOPe Domain Sequences for d1hova_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hova_ d.92.1.11 (A:) MMP-2 {Human (Homo sapiens) [TaxId: 9606]}
mynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgead
iminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtntsanyslflvaah
efghamglehsqdpgalmapiytytknfrlsqddikgiqelyg

SCOPe Domain Coordinates for d1hova_:

Click to download the PDB-style file with coordinates for d1hova_.
(The format of our PDB-style files is described here.)

Timeline for d1hova_: