Lineage for d1ho0a_ (1ho0 A:)
- Root: SCOP 1.75
Class j: Peptides [58231] (121 folds) 
Fold j.75: Isolated insulin B-chain [58773] (1 superfamily) Superfamily j.75.1: Isolated insulin B-chain [58774] (1 family) 
Family j.75.1.1: Isolated insulin B-chain [58775] (1 protein) Protein Isolated insulin B-chain [58776] (3 species) 
Species Synthetic, based on Bos taurus sequence [58777] (1 PDB entry) 
Domain d1ho0a_: 1ho0 A: [46372]
Details for d1ho0a_
PDB Entry: 1ho0 (more details)
PDB Description: new b-chain mutant of bovine insulin
PDB Compounds: (A:) insulinSCOP Domain Sequences for d1ho0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ho0a_ j.75.1.1 (A:) Isolated insulin B-chain {Synthetic, based on Bos taurus sequence}
fvnqhlsgshlvealylvsgergffytpka
SCOP Domain Coordinates for d1ho0a_:
Click to download the PDB-style file with coordinates for d1ho0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ho0a_:
- d1ho0a_ first appeared (with stable ids) in SCOP 1.55
- d1ho0a_ appears in SCOP 1.73
- d1ho0a_ appears in SCOPe 2.01
- d1ho0a_ appears in the current release, SCOPe 2.08
View in 3D