Lineage for d1hnnb_ (1hnn B:)
- Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) 
Family c.66.1.15: Arylamine N-methyltransferase [69547] (2 proteins) 
Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69549] (11 PDB entries) 
Domain d1hnnb_: 1hnn B: [65896]
complexed with sah, skf
Details for d1hnnb_
PDB Entry: 1hnn (more details), 2.4 Å
PDB Description: crystal structure of human pnmt complexed with sk&f 29661 and adohcy(sah)
PDB Compounds: (B:) Phenylethanolamine N-methyltransferaseSCOP Domain Sequences for d1hnnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnnb_ c.66.1.15 (B:) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}
pdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgr
tlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacli
egkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlas
fqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdl
rtyimpahlqtgvddvkgvffawaqkv
SCOP Domain Coordinates for d1hnnb_:
Click to download the PDB-style file with coordinates for d1hnnb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hnnb_:
- d1hnnb_ first appeared in SCOP 1.59
- d1hnnb_ appears in SCOP 1.71
- d1hnnb_ appears in SCOP 1.75
- d1hnnb_ appears in the current release, SCOPe 2.08
View in 3D
