Lineage for d1hnaa1 (1hna A:85-217)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713057Protein Class mu GST [81348] (3 species)
  7. 2713065Species Human (Homo sapiens) [TaxId:9606] [47622] (17 PDB entries)
    Uniprot P09488 P28161
  8. 2713068Domain d1hnaa1: 1hna A:85-217 [17604]
    Other proteins in same PDB: d1hnaa2
    complexed with gdn

Details for d1hnaa1

PDB Entry: 1hna (more details), 1.85 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1hnaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnaa1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk

SCOPe Domain Coordinates for d1hnaa1:

Click to download the PDB-style file with coordinates for d1hnaa1.
(The format of our PDB-style files is described here.)

Timeline for d1hnaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnaa2