Lineage for d1hlca_ (1hlc A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) 
Protein S-lac lectin, L-14-II [100927] (1 species) Species Human (Homo sapiens) [TaxId:9606] [100928] (1 PDB entry) 
Domain d1hlca_: 1hlc A: [24208]
Details for d1hlca_
PDB Entry: 1hlc (more details), 2.9 Å
PDB Description: x-ray crystal structure of the human dimeric s-lac lectin, l-14-ii, in complex with lactose at 2.9 angstroms resolution
PDB Compounds: (A:) human lectinSCOPe Domain Sequences for d1hlca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlca_ b.29.1.3 (A:) S-lac lectin, L-14-II {Human (Homo sapiens) [TaxId: 9606]}
elevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsldgs
nwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvrggf
nmssfklke
SCOPe Domain Coordinates for d1hlca_:
Click to download the PDB-style file with coordinates for d1hlca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hlca_:
- d1hlca_ first appeared (with stable ids) in SCOP 1.55
- d1hlca_ appears in SCOPe 2.05
- d1hlca_ appears in SCOPe 2.07
- d1hlca_ appears in the current release, SCOPe 2.08
View in 3D
