Lineage for d1hlca_ (1hlc A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050578Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2050767Protein S-lac lectin, L-14-II [100927] (1 species)
  7. 2050768Species Human (Homo sapiens) [TaxId:9606] [100928] (1 PDB entry)
  8. 2050769Domain d1hlca_: 1hlc A: [24208]

Details for d1hlca_

PDB Entry: 1hlc (more details), 2.9 Å

PDB Description: x-ray crystal structure of the human dimeric s-lac lectin, l-14-ii, in complex with lactose at 2.9 angstroms resolution
PDB Compounds: (A:) human lectin

SCOPe Domain Sequences for d1hlca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlca_ b.29.1.3 (A:) S-lac lectin, L-14-II {Human (Homo sapiens) [TaxId: 9606]}
elevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsldgs
nwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvrggf
nmssfklke

SCOPe Domain Coordinates for d1hlca_:

Click to download the PDB-style file with coordinates for d1hlca_.
(The format of our PDB-style files is described here.)

Timeline for d1hlca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hlcb_