Lineage for d1hkqa_ (1hkq A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.10: Replication initiation protein [46816] (3 proteins)
duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry
Protein Replication protein A, repA [88982] (1 species) Species Pseudomonas syringae pv. savastanoi [TaxId:29438] [88983] (1 PDB entry) 
Domain d1hkqa_: 1hkq A: [83555]
inactive, dimeric N-terminal domain
complexed with bez, hg, po4
Details for d1hkqa_
PDB Entry: 1hkq (more details), 2.75 Å
PDB Description: pps10 plasmid dna replication initiator protein repa. replication inactive, dimeric n-terminal domain.
PDB Compounds: (A:) replication proteinSCOPe Domain Sequences for d1hkqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkqa_ a.4.5.10 (A:) Replication protein A, repA {Pseudomonas syringae pv. savastanoi [TaxId: 29438]}
qsnkliesshtltlnekrlvlcaaslidsrkplpkdgyltiradtfaevfgidvkhayaa
lddaatklfnrdirryvkgkvvermrwvfhvkyregqgcvelgfsptiiphltmlhkeft
syqlk
SCOPe Domain Coordinates for d1hkqa_:
Click to download the PDB-style file with coordinates for d1hkqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hkqa_:
- d1hkqa_ first appeared in SCOP 1.65
- d1hkqa_ appears in SCOPe 2.07
View in 3D
