![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53071] (7 PDB entries) |
![]() | Domain d1hjoa2: 1hjo A:189-382 [33426] complexed with adp, ca, cl |
PDB Entry: 1hjo (more details), 2.3 Å
SCOPe Domain Sequences for d1hjoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjoa2 c.55.1.1 (A:189-382) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]} gkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrk hkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfeelcsd lfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdea vaygaavqaailmg
Timeline for d1hjoa2: