Lineage for d1hh8a_ (1hh8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726739Protein Neutrophil cytosolic factor 2 (NCF-2, p67-phox) [48460] (1 species)
  7. 2726740Species Human (Homo sapiens) [TaxId:9606] [48461] (2 PDB entries)
  8. 2726741Domain d1hh8a_: 1hh8 A: [61042]
    complexed with flc; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1hh8a_

PDB Entry: 1hh8 (more details), 1.8 Å

PDB Description: the active n-terminal region of p67phox: structure at 1.8 angstrom resolution and biochemical characterizations of the a128v mutant implicated in chronic granulomatous disease
PDB Compounds: (A:) neutrophil cytosol factor 2

SCOPe Domain Sequences for d1hh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}
slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft
rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac
evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgr
lfrpnerqvaql

SCOPe Domain Coordinates for d1hh8a_:

Click to download the PDB-style file with coordinates for d1hh8a_.
(The format of our PDB-style files is described here.)

Timeline for d1hh8a_: