Lineage for d1hh1a_ (1hh1 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490411Family c.52.1.18: Hjc-like [64080] (3 proteins)
    Pfam PF01870
  6. 2490412Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species)
  7. 2490420Species Sulfolobus solfataricus [TaxId:2287] [64083] (1 PDB entry)
  8. 2490421Domain d1hh1a_: 1hh1 A: [61036]

Details for d1hh1a_

PDB Entry: 1hh1 (more details), 2.15 Å

PDB Description: the structure of hjc, a holliday junction resolving enzyme from sulfolobus solfataricus
PDB Compounds: (A:) holliday junction resolving enzyme hjc

SCOPe Domain Sequences for d1hh1a_:

Sequence, based on SEQRES records: (download)

>d1hh1a_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Sulfolobus solfataricus [TaxId: 2287]}
savernivsrlrdkgfavvrapasgskrkdpipdiialkngviiliemksrkdiegkiyv
rreqaegiiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlv
rlveakisrtld

Sequence, based on observed residues (ATOM records): (download)

>d1hh1a_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Sulfolobus solfataricus [TaxId: 2287]}
savernivsrlrdkgfavvrapapipdiialkngviiliemksrkdiegkiyvrreqaeg
iiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrlveaki
srtld

SCOPe Domain Coordinates for d1hh1a_:

Click to download the PDB-style file with coordinates for d1hh1a_.
(The format of our PDB-style files is described here.)

Timeline for d1hh1a_: