![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88820] (1 PDB entry) |
![]() | Domain d1hdmb2: 1hdm B:3-87 [38158] Other proteins in same PDB: d1hdma1, d1hdma2, d1hdmb1 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1hdm (more details), 2.5 Å
SCOPe Domain Sequences for d1hdmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdmb2 d.19.1.1 (B:3-87) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcnslanvlsqhlnqkdt lmqrlnglqncathtqpfwgsltnr
Timeline for d1hdmb2: